General Information

  • ID:  hor005569
  • Uniprot ID:  D2IT41
  • Protein name:  PDH precursor-related peptide
  • Gene name:  NA
  • Organism:  Eurydice pulchra (Speckled sea louse)
  • Family:  Arthropod PDH family
  • Source:  Animal
  • Expression:  Does not display circadian or circatidal patterns of expression. |Strongly expressed in eyestalk tissue and cerebral ganglia (at protein level).
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Eurydice (genus), Cirolanidae (family), Flabellifera, Isopoda (order), Peracarida (superorder), Eumalacostraca (subclass), Malacostraca (class), Multicrustacea (superclass), Crustacea (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission; GO:0009416 response to light stimulus; GO:0051904 pigment granule transport
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0045202 synapse

Sequence Information

  • Sequence:  QSRDFSISEREIVASLAKQLLRVARMGYVPEGDLPR
  • Length:  36(25-60)
  • Propeptide:  MRFIILGVLFIAVASMILSNGVMAQSRDFSISEREIVASLAKQLLRVARMGYVPEGDLPRKRNAELINSLLGVPRVMSDAGRR
  • Signal peptide:  MRFIILGVLFIAVASMILSNGVMA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The pigment-dispersing hormone causes the migration of the distal retinal pigment into the proximal end of the pigment chromatophore cells and thus decreases the amount of light entering the retinulas. May also function as a neurotransmitter and/or neurom
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q80T19-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor005569_AF2.pdbhor005569_ESM.pdb

Physical Information

Mass: 471316 Formula: C178H296N54O54S
Absent amino acids: CHNTW Common amino acids: R
pI: 9.29 Basic residues: 6
Polar residues: 7 Hydrophobic residues: 13
Hydrophobicity: -34.72 Boman Index: -8856
Half-Life / Aliphatic Index: 0.8 hour Aliphatic Index: 97.5
Instability Index: 5652.78 Extinction Coefficient cystines: 1490
Absorbance 280nm: 42.57

Literature

  • PubMed ID:  21192084
  • Title:  A novel form of pigment-dispersing hormone in the central nervous system of the intertidal marine isopod, Eurydice pulchra (leach).